PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000183558
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 330aa    MW: 37852.6 Da    PI: 6.4046
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000183558genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM116.52.7e-36181451127
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                    +p+GfrF+Pt+eelv++yL+ k+eg +  +++v +e+di+++ P+dLp  + vk++++ewy Fs+ +k +  +++  ratk+g+W  tg+ k+v++
  MDP0000183558  18 VPVGFRFRPTEEELVHYYLQMKLEGMDYIVSDVXSEIDICNHXPRDLPglSLVKSDDQEWYLFSTYKKXS--KNQIVRATKEGFWXVTGERKQVKT 111
                    599************************99999****************6448889999******998865..56999*****************99 PP

            NAM  95 k.kgelvglkktLvfykgrapkgektdWvmheyr 127
                      k++++g k+ L+f +gr +++++tdWvmhey 
  MDP0000183558 112 XdKRSVIGEKRXLTFKQGRVRNPQNTDWVMHEYY 145
                    867778***************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.85E-379151IPR003441NAC domain
PROSITE profilePS5100538.30318188IPR003441NAC domain
PfamPF023651.0E-2019145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MAPNGSRFTR ASAGDILVPV GFRFRPTEEE LVHYYLQMKL EGMDYIVSDV XSEIDICNHX  60
PRDLPGLSLV KSDDQEWYLF STYKKXSKNQ IVRATKEGFW XVTGERKQVK TXDKRSVIGE  120
KRXLTFKQGR VRNPQNTDWV MHEYYIPKPI LMIIRGFGSE TIERIEIETL GAKLVFNRDL  180
VVCCVKKKSG ENVDAANCXE XESSTYNNNA SDFENQQLLA PGMDIEXLFS DRAVAQCDRP  240
GSKKIGGTKY IKEHLGESET RLLTRASTNK TSYAGCFEAR GQQECWWYSI YVSSSSWLDW  300
HYFGVHSEED MTGRAPHIPW ALPLLDNEMC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-1951462140Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.69203e-34bud| fruit| leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM5XNS91e-54M5XNS9_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13478522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33060.16e-33NAC 014